Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial

Product Specifications

Product Name Alternative

Coagulation factor IIIThromboplastin; CD142

Abbreviation

Recombinant Human F3 protein, partial

Gene Name

F3

UniProt

P13726

Expression Region

33-251aa

Organism

Homo sapiens (Human)

Target Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hostasis by initiating the cell-surface assbly and propagation of the coagulation protease cascade.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF

Molecular Weight

40.8 kDa

References & Citations

Human tissue factor cDNA sequence and chromosome localization of the gene.Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E.Biochemistry 26:5234-5238 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK2 Rabbit mAb
E2R383065 100 µL

IRAK2 Rabbit mAb

Sign In for Pricing
View Details
INT4 ORF Vector (Human) (pORF)
25005012 1.0 µg DNA

INT4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DKK1 Antibody: HRP
MBS8001610-01 0.1 mg

DKK1 Antibody: HRP

Sign In for Pricing
View Details
DKK1 Antibody: HRP
MBS8001610-02 5x 0.1 mg

DKK1 Antibody: HRP

Sign In for Pricing
View Details
Human DHRS3 Recombinant Protein
PPT-12259 100 µg

Human DHRS3 Recombinant Protein

Sign In for Pricing
View Details
Unc119b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3528004 1.0 µg DNA

Unc119b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details