Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial

Product Specifications

Product Name Alternative

1600029N02Rik; Echinoderm microtubule associated protein like 2; Echinoderm microtubule-associated protein-like 2; Echinoderm MT associated protein like protein 70; ELP70; EMAL2_HUMAN; EMAP-2; EMAP2; EML2; HuEMAP-2

Abbreviation

Recombinant Human EML2 protein, partial

Gene Name

EML2

UniProt

O95834

Expression Region

1-418aa

Organism

Homo sapiens (Human)

Target Sequence

MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Molecular Weight

61.8 kDa

References & Citations

Crystal structure of EML1 reveals the basis for Hsp90 dependence of oncogenic EML4-ALK by disruption of an atypical ?-propeller domain.Richards M.W., Law E.W., Rennalls L.P., Busacca S., O'Regan L., Fry A.M., Fennell D.A., Bayliss R.Proc. Natl. Acad. Sci. U.S.A. 111:5195-5200 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 750) discontinued
133991-ML750 100 µL

STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DPEP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0626706 1.0 µg DNA

DPEP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
AKT phospholatyed (Thr34) (Akt1, PKB, PRKBA, RAC, RAC-ALPHA) (PE) discontinued
A1124-09B-PE 100 µL

AKT phospholatyed (Thr34) (Akt1, PKB, PRKBA, RAC, RAC-ALPHA) (PE) discontinued

Sign In for Pricing
View Details
2,4-Ditert-butoxypyrimidin-5-ylboronic acid
sc-288435 250 mg

2,4-Ditert-butoxypyrimidin-5-ylboronic acid

Sign In for Pricing
View Details
Mouse Upstream stimulatory factor 1 (USF1) ELISA Kit
MBS287373-01 48 Tests

Mouse Upstream stimulatory factor 1 (USF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Upstream stimulatory factor 1 (USF1) ELISA Kit
MBS287373-02 96 Tests

Mouse Upstream stimulatory factor 1 (USF1) ELISA Kit

Sign In for Pricing
View Details