Recombinant Human DTW domain-containing protein 1 (DTWD1), partial
Product Specifications
Product Name Alternative
DTW domain containing 1; DTW domain-containing protein 1; Dtwd1; DTWD1_HUMAN; MDS009; x 009 protein
Abbreviation
Recombinant Human DTWD1 protein, partial
Gene Name
DTWD1
UniProt
Q8N5C7
Expression Region
1-109aa
Organism
Homo sapiens (Human)
Target Sequence
MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI
Tag
N-terminal GST-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
39.2 kDa
References & Citations
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Napsin A Antibody (NAPSA/1238) [CoraFluor 1]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-54383CL1 0.1 mL
Mouse Monoclonal Napsin A Antibody (NAPSA/1238) [CoraFluor 1]
Sign In for Pricing
View Details 
MBS7235714-01 48 Well
Human UbiA prenyltransferase domain containing protein 1 (UBIAD1) ELISA Kit
Sign In for Pricing
View Details MBS7235714-02 96 Well
Human UbiA prenyltransferase domain containing protein 1 (UBIAD1) ELISA Kit
Sign In for Pricing
View Details MBS7235714-03 5x 96 Well
Human UbiA prenyltransferase domain containing protein 1 (UBIAD1) ELISA Kit
Sign In for Pricing
View Details