Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DTW domain-containing protein 1 (DTWD1), partial

Product Specifications

Product Name Alternative

DTW domain containing 1; DTW domain-containing protein 1; Dtwd1; DTWD1_HUMAN; MDS009; x 009 protein

Abbreviation

Recombinant Human DTWD1 protein, partial

Gene Name

DTWD1

UniProt

Q8N5C7

Expression Region

1-109aa

Organism

Homo sapiens (Human)

Target Sequence

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.2 kDa

References & Citations

N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM5 AAV Vector (Mouse) (CMV)
11225104 1 µg

ACSM5 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Human TREM-1 Recombinant Protein
PROTQ9NP99-500ug 500 µg

Human TREM-1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human ESAM (C-6His)
PHH0606-01 10 µg

Recombinant Human ESAM (C-6His)

Sign In for Pricing
View Details
Recombinant Human ESAM (C-6His)
PHH0606-02 50 µg

Recombinant Human ESAM (C-6His)

Sign In for Pricing
View Details
Recombinant Human ESAM (C-6His)
PHH0606-03 500 µg

Recombinant Human ESAM (C-6His)

Sign In for Pricing
View Details
CDK4 inhibitor
B1233-25 25 mg

CDK4 inhibitor

Sign In for Pricing
View Details