Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Desmoplakin (DSP), partial

Product Specifications

Product Name Alternative

250/210KDA paraneoplastic pemphigus antigen

Abbreviation

Recombinant Human DSP protein, partial

Gene Name

DSP

UniProt

P15924

Expression Region

78-300aa

Organism

Homo sapiens (Human)

Target Sequence

CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma mbrane domains and in the anchoring of intermediate filaments to the desmosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes.

Molecular Weight

42.1 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Numb (phospho-Ser276) rabbit pAb
MBS8600068-01 0.1 mL

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details
Numb (phospho-Ser276) rabbit pAb
MBS8600068-02 0.1 mL (AF405L)

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details
Numb (phospho-Ser276) rabbit pAb
MBS8600068-03 0.1 mL (AF405S)

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details
Numb (phospho-Ser276) rabbit pAb
MBS8600068-04 0.1 mL (AF610)

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details
Numb (phospho-Ser276) rabbit pAb
MBS8600068-05 0.1 mL (AF635)

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details
Numb (phospho-Ser276) rabbit pAb
MBS8600068-06 0.1 mL (APC)

Numb (phospho-Ser276) rabbit pAb

Sign In for Pricing
View Details