Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Density-regulated protein (DENR)

Product Specifications

Product Name Alternative

Protein DRP1Smooth muscle cell-associated protein 3 ; SMAP-3

Abbreviation

Recombinant Human DENR protein

Gene Name

DENR

UniProt

O43583

Expression Region

2-198aa

Organism

Homo sapiens (Human)

Target Sequence

AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitmnet of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitmnet of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.

Molecular Weight

38 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2)
MBS644354-01 0.2 mL

OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2)

Sign In for Pricing
View Details
OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2)
MBS644354-02 5x 0.2 mL

OR13J1, CT (OR13J1, Olfactory receptor 13J1, Olfactory receptor OR9-2)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Regulatory protein recX (recX)
MBS1337905-01 0.02 mg (E-Coli)

Recombinant Pseudomonas entomophila Regulatory protein recX (recX)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Regulatory protein recX (recX)
MBS1337905-02 0.1 mg (E-Coli)

Recombinant Pseudomonas entomophila Regulatory protein recX (recX)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Regulatory protein recX (recX)
MBS1337905-03 0.02 mg (Yeast)

Recombinant Pseudomonas entomophila Regulatory protein recX (recX)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Regulatory protein recX (recX)
MBS1337905-04 0.1 mg (Yeast)

Recombinant Pseudomonas entomophila Regulatory protein recX (recX)

Sign In for Pricing
View Details