Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dynactin subunit 3 (DCTN3)

Product Specifications

Product Name Alternative

Dynactin complex subunit 22KDA subunit ; p22

Abbreviation

Recombinant Human DCTN3 protein

Gene Name

DCTN3

UniProt

O75935

Expression Region

2-176aa

Organism

Homo sapiens (Human)

Target Sequence

AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Cycle

Relevance

Together with dynein may be involved in spindle assbly and cytokinesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Together with dynein may be involved in spindle assembly and cytokinesis.

Molecular Weight

35.3 kDa

References & Citations

Characterization of the p22 subunit of dynactin reveals the localization of Cytoplasmic domain dynein and dynactin to the midbody of dividing cells.Karki S., LaMonte B., Holzbaur E.L.F.J. Cell Biol. 142:1023-1034 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF640R conjugate, 0.1mg/mL
BNC403179-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS631975 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
4’’-Descyano,4’’carboxaamido-enzalutmaide
TRC-A658545-2.5MG 2.5 mg

4’’-Descyano,4’’carboxaamido-enzalutmaide

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]
AN00421M-01 20 Tests

Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]
AN00421M-02 100 Tests

Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]
AN00421M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details