Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Decorin (Dcn), partial

Product Specifications

Product Name Alternative

Bone proteoglycan IIPG-S2; PG40

Abbreviation

Recombinant Mouse Dcn protein, partial

Gene Name

Dcn

UniProt

P28654

Expression Region

35-354aa

Organism

Mus musculus (Mouse)

Target Sequence

GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May affect the rate of fibrils formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May affect the rate of fibrils formation.

Molecular Weight

51.9 kDa

References & Citations

Naitoh Y., Suzuki S. The murine decorin. Complete cDNA cloning, genomic organization, chromosomal assignment, and expression during organogenesis and tissue differentiation.Scholzen T., Solursh M., Suzuki S., Reiter R., Morgan J.L., Buchberg A.M., Siracusa L.D., Iozzo R.V.J. Biol. Chem. 269:28270-28281 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flask Pyrex nn HD 4Ltr
FLA4099 1 Each

Flask Pyrex nn HD 4Ltr

Sign In for Pricing
View Details
HSD3B2 Rabbit pAb Antibody
orb3016590 100 µL

HSD3B2 Rabbit pAb Antibody

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit
orb2667761-01 48 Tests

Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit
orb2667761-02 96 Tests

Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit

Sign In for Pricing
View Details
ARH3/ADPRHL2 Antibody
MBS851417-01 0.2 mL

ARH3/ADPRHL2 Antibody

Sign In for Pricing
View Details
ARH3/ADPRHL2 Antibody
MBS851417-02 0.1 mL (AF405L)

ARH3/ADPRHL2 Antibody

Sign In for Pricing
View Details