Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dermcidin (DCD)

Product Specifications

Product Name Alternative

Preproteolysin

Abbreviation

Recombinant Human DCD protein

Gene Name

DCD

UniProt

P81605

Expression Region

20-110aa

Organism

Homo sapiens (Human)

Target Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resble the conditions in sweat. Also exhibits proteolytic activity.Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues

Molecular Weight

36.3 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2IRD1 Rabbit Polyclonal Antibody (Cy3)
orb979756 100 µL

GTF2IRD1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CALD1 Knockout 769-P Polyclonal Cells
ARG41820 1 Million

CALD1 Knockout 769-P Polyclonal Cells

Sign In for Pricing
View Details
Human uPA ELISA Kit
BEK1222 96 Tests

Human uPA ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)
MBS2003862-01 0.1 mL

Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)
MBS2003862-02 0.2 mL

Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)
MBS2003862-03 0.5 mL

Biotin-Linked Antibody to Interleukin 2 Receptor Gamma (IL2Rg)

Sign In for Pricing
View Details