What is the catalog number for Recombinant Human Acyl-CoA-binding protein (DBI)?

The catalog number for Recombinant Human Acyl-CoA-binding protein (DBI) is CSB-EP006519HU.

What sizes are available for Recombinant Human Acyl-CoA-binding protein (DBI)?

Recombinant Human Acyl-CoA-binding protein (DBI) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Acyl-CoA-binding protein (DBI) come in?

Recombinant Human Acyl-CoA-binding protein (DBI) is available in 7 different pack sizes.

Is Recombinant Human Acyl-CoA-binding protein (DBI) in stock?

Recombinant Human Acyl-CoA-binding protein (DBI) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Acyl-CoA-binding protein (DBI)?

Recombinant Human Acyl-CoA-binding protein (DBI) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Acyl-CoA-binding protein (DBI)?

Estimated delivery time for Recombinant Human Acyl-CoA-binding protein (DBI) is approximately 15 business day(s), depending on your location.

Recombinant Human Acyl-CoA-binding protein (DBI)

Product Specifications

Product Name Alternative

Diazepam-binding inhibitor ; DBIEndozepine ; EP

Abbreviation

Recombinant Human DBI protein

Gene Name

DBI

UniProt

P07108

Expression Region

2-104aa

Organism

Homo sapiens (Human)

Target Sequence

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Molecular Weight

15.7 kDa

References & Citations

Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor.Gray P.W., Glaister D., Seeburg P.H., Guidotti A., Costa E.Proc. Natl. Acad. Sci. U.S.A. 83:7547-7551 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.