Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acyl-CoA-binding protein (DBI)

Product Specifications

Product Name Alternative

Diazepam-binding inhibitor ; DBIEndozepine ; EP

Abbreviation

Recombinant Human DBI protein

Gene Name

DBI

UniProt

P07108

Expression Region

2-104aa

Organism

Homo sapiens (Human)

Target Sequence

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Molecular Weight

15.7 kDa

References & Citations

Cloning and expression of cDNA for human diazepam binding inhibitor, a natural ligand of an allosteric regulatory site of the gamma-aminobutyric acid type A receptor.Gray P.W., Glaister D., Seeburg P.H., Guidotti A., Costa E.Proc. Natl. Acad. Sci. U.S.A. 83:7547-7551 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Carbonic Anhydrase XIV / Car14 Protein (His tag)
E53A06385 50 µg

Recombinant Mouse Carbonic Anhydrase XIV / Car14 Protein (His tag)

Ask
View Details
Human ETS translocation variant 1, ETV1 ELISA KIT
ELI-09963h 96 Tests

Human ETS translocation variant 1, ETV1 ELISA KIT

Ask
View Details
Mouse Monoclonal BAP1 Antibody (BAP1/2665) [HRP]
NBP3-08506H 100 µL

Mouse Monoclonal BAP1 Antibody (BAP1/2665) [HRP]

Ask
View Details
Human HSD17B14 knockdown cell line
ABC-KD7029 1 Vial

Human HSD17B14 knockdown cell line

Ask
View Details
Brilliant Violet 421™ anti-human CD133
GT16434 100 Tests

Brilliant Violet 421™ anti-human CD133

Ask
View Details