Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytoglobin (CYGB)

Product Specifications

Product Name Alternative

Histoglobin ; HGbStellate cell activation-associated protein

Abbreviation

Recombinant Human CYGB protein

Gene Name

CYGB

UniProt

Q8WWM9

Expression Region

1-190aa

Organism

Homo sapiens (Human)

Target Sequence

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.

Molecular Weight

37.4 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep A kinase anchor protein 13 (AKAP13) ELISA kit
GTR10397439 96 Well

Sheep A kinase anchor protein 13 (AKAP13) ELISA kit

Sign In for Pricing
View Details
Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit
MBS9926385-01 48 Well

Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit

Sign In for Pricing
View Details
Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit
MBS9926385-02 96 Well

Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit

Sign In for Pricing
View Details
Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit
MBS9926385-03 5x 96 Well

Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit

Sign In for Pricing
View Details
Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit
MBS9926385-04 10x 96 Well

Monkey ATP-Sensitive Inward Rectifier Potassium Channel 14 (KCNJ14) ELISA Kit

Sign In for Pricing
View Details
Human CRYGD shRNA Plasmid
abx951002-01 150 µg

Human CRYGD shRNA Plasmid

Sign In for Pricing
View Details