Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c (CYCS)

Product Specifications

Product Name Alternative

CYC; CYC_HUMAN; CYCS; Cytochrome c; Cytochrome c somatic; HCS; THC4

Abbreviation

Recombinant Human CYCS protein

Gene Name

CYCS

UniProt

P99999

Expression Region

2-105aa

Organism

Homo sapiens (Human)

Target Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Electron carrier protein. The oxidized form of the cytochrome c he group can accept an electron from the he group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.Plays a role in apoptosis. Suppression of the anti-apoptotic mbers or activation of the pro-apoptotic mbers of the Bcl-2 family leads to altered mitochondrial mbrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; FUNCTION

Molecular Weight

38.6 kDa

References & Citations

The human somatic cytochrome c gene two classes of processed pseudogenes demarcate a period of rapid molecular evolution.Evans M.J., Scarpulla R.C.Proc. Natl. Acad. Sci. U.S.A. 85:9625-9629 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NALP2 (NLRP2) Human qPCR Template Standard (NM_017852)
HK205144 1 Kit

NALP2 (NLRP2) Human qPCR Template Standard (NM_017852)

Ask
View Details
Apolipoprotein H, Western Blot Positive Control (Beta-2-glycoprotein 1, APC Inhibitor, Activated Protein C-binding Protein, Anticardiolipin Cofactor, Apolipoprotein H, Apo-H, Beta-2-glycoprotein I, B2GPI, Beta (2) GPI, B2G1)
A2299-77Y 100 µL

Apolipoprotein H, Western Blot Positive Control (Beta-2-glycoprotein 1, APC Inhibitor, Activated Protein C-binding Protein, Anticardiolipin Cofactor, Apolipoprotein H, Apo-H, Beta-2-glycoprotein I, B2GPI, Beta (2) GPI, B2G1)

Ask
View Details
SAPK1, JNK (Stress Activated Protein Kinase, Jun Kinase) (Thr183/Tyr185) BioAssayTM Phosphorylation Detection Kit discontinued
S0096-04D 1 Kit

SAPK1, JNK (Stress Activated Protein Kinase, Jun Kinase) (Thr183/Tyr185) BioAssayTM Phosphorylation Detection Kit discontinued

Ask
View Details
LOC634601 Mouse siRNA Oligo Duplex (Locus ID 634601)
SR412705 1 Kit

LOC634601 Mouse siRNA Oligo Duplex (Locus ID 634601)

Ask
View Details
Rabbit Polyclonal HIBCH Antibody [Alexa Fluor 350]
NBP3-06399AF350 0.1 mL

Rabbit Polyclonal HIBCH Antibody [Alexa Fluor 350]

Ask
View Details