Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin S (Ctss)

Product Specifications

Product Name Alternative

Ctss; CatsCathepsin S; EC 3.4.22.27

Abbreviation

Recombinant Mouse ctss protein

Gene Name

Ctss

UniProt

O70370

Expression Region

123-340aa

Organism

Mus musculus (Mouse)

Target Sequence

LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Molecular Weight

27.7 kDa

References & Citations

Doh-ura K.Rommerskirch W. Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit
MBS7252522-01 48 Well

Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit

Sign In for Pricing
View Details
Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit
MBS7252522-02 96 Well

Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit

Sign In for Pricing
View Details
Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit
MBS7252522-03 5x 96 Well

Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit

Sign In for Pricing
View Details
Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit
MBS7252522-04 10x 96 Well

Canine Chondroitin sulfate proteoglycan 4 (CSPG4) ELISA Kit

Sign In for Pricing
View Details
LZIC CRISPRa sgRNA lentivector (set of three targets)(Rat)
27868126 3x 1.0µg DNA

LZIC CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Human CHD3 Protein, N-His
orb2835458-01 20 µg

Recombinant Human CHD3 Protein, N-His

Sign In for Pricing
View Details