Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cathepsin K (Ctsk)

Product Specifications

Product Name Alternative

Ctsk; Cathepsin K; EC 3.4.22.38

Abbreviation

Recombinant Rat Ctsk protein

Gene Name

Ctsk

UniProt

O35186

Expression Region

115-329aa

Organism

Rattus norvegicus (Rat)

Target Sequence

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation (By similarity) .

Molecular Weight

27.5 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD7 Protein Vector (Human) (pPM-C-HA)
PV065131 500 ng

BTBD7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit
MBS9359319-01 48 Well

Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit

Sign In for Pricing
View Details
Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit
MBS9359319-02 96 Well

Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit

Sign In for Pricing
View Details
Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit
MBS9359319-03 5x 96 Well

Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit

Sign In for Pricing
View Details
Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit
MBS9359319-04 10x 96 Well

Porcine Gap Junction Delta 2 Protein (GJD2) ELISA Kit

Sign In for Pricing
View Details
Dok2 (NM_010071) Mouse Tagged ORF Clone Lentiviral Particle
MR206494L3V 200 µL

Dok2 (NM_010071) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details