Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cancer/testis antigen 2 (CTAG2)

Product Specifications

Product Name Alternative

Autoimmunogenic cancer/testis antigen NY-ESO-2; Cancer/testis antigen 6.2 ; CT6.2L antigen family member 1 ; LAGE-1

Abbreviation

Recombinant Human CTAG2 protein

Gene Name

CTAG2

UniProt

O75638

Expression Region

1-210aa

Organism

Homo sapiens (Human)

Target Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.1 kDa

References & Citations

Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIGN (C-term) Rabbit Polyclonal Antibody
AP51671PU-N 400 µL

FIGN (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PON1/PON2 Antibody (Biotin)
KB-3774-01 50 μL

PON1/PON2 Antibody (Biotin)

Sign In for Pricing
View Details
PON1/PON2 Antibody (Biotin)
KB-3774-02 100 µL

PON1/PON2 Antibody (Biotin)

Sign In for Pricing
View Details
PON1/PON2 Antibody (Biotin)
KB-3774-03 1 mL

PON1/PON2 Antibody (Biotin)

Sign In for Pricing
View Details
Tex261 (NM_009357) Mouse Tagged ORF Clone
MG201927 10 µg

Tex261 (NM_009357) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant beta 2 Adrenergic Receptor Antibody
RC-16888-01 50 μL

Recombinant beta 2 Adrenergic Receptor Antibody

Sign In for Pricing
View Details