Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial

Product Specifications

Product Name Alternative

CDw116; CD116

Abbreviation

Recombinant Human CSF2RA protein, partial

Gene Name

CSF2RA

UniProt

P15509

Expression Region

23-320aa

Organism

Homo sapiens (Human)

Target Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hatopoietic cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Molecular Weight

50.5 kDa

References & Citations

Cloning and sequencing of the cDNA variant with 397 bp missing for the GM-CSF receptor alpha subunit.Hu X., Zuckerman K.S.Discovery and characterization of a novel splice variant of the GM-CSF receptor alpha subunit.Pelley J.L., Nicholls C.D., Beattie T.L., Brown C.B.Exp. Hematol. 35:1483-1494 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100a3 siRNA Oligos set (Rat)
42935176 3x 5 nmol

S100a3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
USP2 Antibody
orb520103-01 50 μL

USP2 Antibody

Sign In for Pricing
View Details
USP2 Antibody
orb520103-02 100 µL

USP2 Antibody

Sign In for Pricing
View Details
Prl8a7 AAV Vector (Rat) (CMV)
37705106 1 µg

Prl8a7 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SH5-07 5mg
A20340-5 5 mg

SH5-07 5mg

Sign In for Pricing
View Details
WHSC2, ID (WHSC2, NELFA, Negative elongation factor A, Wolf-Hirschhorn syndrome candidate 2 protein) (FITC)
MBS6363591-01 0.2 mL

WHSC2, ID (WHSC2, NELFA, Negative elongation factor A, Wolf-Hirschhorn syndrome candidate 2 protein) (FITC)

Sign In for Pricing
View Details