What is the catalog number for Recombinant Human Alpha-crystallin B chain (CRYAB)?

The catalog number for Recombinant Human Alpha-crystallin B chain (CRYAB) is CSB-EP006008HU.

What sizes are available for Recombinant Human Alpha-crystallin B chain (CRYAB)?

Recombinant Human Alpha-crystallin B chain (CRYAB) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Alpha-crystallin B chain (CRYAB) come in?

Recombinant Human Alpha-crystallin B chain (CRYAB) is available in 7 different pack sizes.

Is Recombinant Human Alpha-crystallin B chain (CRYAB) in stock?

Recombinant Human Alpha-crystallin B chain (CRYAB) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Alpha-crystallin B chain (CRYAB)?

Recombinant Human Alpha-crystallin B chain (CRYAB) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Alpha-crystallin B chain (CRYAB)?

Estimated delivery time for Recombinant Human Alpha-crystallin B chain (CRYAB) is approximately 15 business day(s), depending on your location.

Recombinant Human Alpha-crystallin B chain (CRYAB)

Product Specifications

Product Name Alternative

Alpha (B) -crystallinHeat shock protein beta-5 ; HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component

Abbreviation

Recombinant Human CRYAB protein

Gene Name

CRYAB

UniProt

P02511

Expression Region

1-175aa

Organism

Homo sapiens (Human)

Target Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Molecular Weight

36.2 kDa

References & Citations

The primary structure of the B2 chain of human alpha-crystallin.Kramps J.A., de Man B.M., de Jong W.W.FEBS Lett. 74:82-84 (1977)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.