Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1), partial

Product Specifications

Product Name Alternative

Corticotropin-releasing hormone receptor 1 ; CRH-R-1 ; CRH-R1

Abbreviation

Recombinant Human CRHR1 protein, partial

Gene Name

CRHR1

UniProt

P34998

Expression Region

24-121aa

Organism

Homo sapiens (Human)

Target Sequence

SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Molecular Weight

37.9 kDa

References & Citations

A novel CRF1 splice isoform involved in neurodegenerative and stress disorders.Sherrin T., Murthy S.R., Spiess J.cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .King M.M., Aronstam R.S., Sharma S.V. Human protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse mmu-miR-196a-2-3p miRNA Antagomir
abx888243-01 10 nmol

Mouse mmu-miR-196a-2-3p miRNA Antagomir

Ask
View Details
Mouse mmu-miR-196a-2-3p miRNA Antagomir
abx888243-02 20 nmol

Mouse mmu-miR-196a-2-3p miRNA Antagomir

Ask
View Details
Rabbit Polyclonal RGS11 Antibody [Alexa Fluor 532]
NBP2-97203AF532 0.1 mL

Rabbit Polyclonal RGS11 Antibody [Alexa Fluor 532]

Ask
View Details
Chrna10 (NM_001081424) Mouse Tagged ORF Clone
MG221355 10 µg

Chrna10 (NM_001081424) Mouse Tagged ORF Clone

Ask
View Details
Slc38a7 siRNA Oligos set (Rat)
44174176 3x 5 nmol

Slc38a7 siRNA Oligos set (Rat)

Ask
View Details
Rabbit Monoclonal Histone H4 [ac Lys12, ac Lys8, ac Lys16] Antibody (KM-2) [mFluor Violet 610 SE]
NBP3-12019MFV610 0.1 mL

Rabbit Monoclonal Histone H4 [ac Lys12, ac Lys8, ac Lys16] Antibody (KM-2) [mFluor Violet 610 SE]

Ask
View Details