Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Chymase (CMA1)

Product Specifications

Product Name Alternative

Alpha-chymase; Mast cell protease I

Abbreviation

Recombinant Dog CMA1 protein

Gene Name

CMA1

UniProt

P21842

Expression Region

22-249aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Molecular Weight

41.5 kDa

References & Citations

Purification and characterization of dog mastocytoma chymase identification of an octapeptide conserved in chymotryptic leukocyte proteinases.Caughey G.H., Viro N.F., Lazarus S.C., Nadel J.A.Biochim. Biophys. Acta 952:142-149 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rfx4 shRNA (UAS) - Lentiviral mouse Rfx4 shRNA (UAS, GFP) (100)
GTR15224985 1 Vial

Lentiviral mouse Rfx4 shRNA (UAS) - Lentiviral mouse Rfx4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TPO Mouse Monoclonal Antibody
orb2957291-01 50 µg

TPO Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TPO Mouse Monoclonal Antibody
orb2957291-02 100 µg

TPO Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TPO Mouse Monoclonal Antibody
orb2957291-03 1 mg

TPO Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human leukotriene E4, LT-E4 ELISA Kit
YLA2674HU-01 48 Tests

Human leukotriene E4, LT-E4 ELISA Kit

Sign In for Pricing
View Details
Human leukotriene E4, LT-E4 ELISA Kit
YLA2674HU-02 96 Tests

Human leukotriene E4, LT-E4 ELISA Kit

Sign In for Pricing
View Details