Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial

Product Specifications

Product Name Alternative

Chrna1; Acra; Acetylcholine receptor subunit alpha

Abbreviation

Recombinant Mouse Chrna1 protein, partial

Gene Name

Chrna1

UniProt

P04756

Expression Region

21-230aa

Organism

Mus musculus (Mouse)

Target Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Molecular Weight

40.5 kDa

References & Citations

Crystal structure of the Extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.Dellisanti C.D., Yao Y., Stroud J.C., Wang Z.Z., Chen L.Nat. Neurosci. 10:953-962 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lce1l CRISPR All-in-one AAV vector set (with saCas9)(Rat)
26352156 3x 1.0 µg DNA

Lce1l CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/4661) [Alexa Fluor 488]
NBP3-21137AF488 0.1 mL

Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/4661) [Alexa Fluor 488]

Sign In for Pricing
View Details
Transforming Growth Factor-Beta 1, Human Recombinant
rAP-6001 1 Each

Transforming Growth Factor-Beta 1, Human Recombinant

Sign In for Pricing
View Details
OR6C73P Protein Vector (Human) (pPB-N-His)
PV108243 500 ng

OR6C73P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TACD2 (TACSTD2) (NM_002353) Human Tagged ORF Clone Lentiviral Particle
RC202519L4V 200 µL

TACD2 (TACSTD2) (NM_002353) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KIF5B Antibody
OAEE00478-100UG 0.1 mg (C100)

KIF5B Antibody

Sign In for Pricing
View Details