Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
Product Specifications
Product Name Alternative
CDKN2A-interacting protein N-terminal-like protein
Abbreviation
Recombinant Human CDKN2AIPNL protein
Gene Name
CDKN2AIPNL
UniProt
Q96HQ2
Expression Region
1-116aa
Organism
Homo sapiens (Human)
Target Sequence
MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
17.2 kDa
References & Citations
"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940262-500 1x 500 µL
Human Lambda Light Chain (HP6054), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP52064PU-N 400 µL
Heme Oxygenase 1 (HMOX1) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2937/imageurl/e-ab-f1242s.webp)
E-AB-F1242S-01 20 Tests
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
Sign In for Pricing
View Details E-AB-F1242S-02 100 Tests
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
Sign In for Pricing
View Details E-AB-F1242S-03 2x 100 Tests
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
Sign In for Pricing
View Details