Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD81 antigen (CD81), partial

Product Specifications

Product Name Alternative

26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ; Tspan-28; CD81

Abbreviation

Recombinant Human CD81 protein, partial

Gene Name

CD81

UniProt

P60033

Expression Region

113-201aa

Organism

Homo sapiens (Human)

Target Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION

Molecular Weight

25.8 kDa

References & Citations

TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL-1B3 (m) -PR
sc-42993-PR 10 µM - 20 µL

TCL-1B3 (m) -PR

Sign In for Pricing
View Details
ESPNL 3'UTR Lenti-reporter-Luc Vector
19496081 1.0 µg

ESPNL 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TLR4 Antibody Middle region
ARP97373_P050 100 µL

TLR4 Antibody Middle region

Sign In for Pricing
View Details
Mouse Spaca7b qPCR Primer Pair
QM44754S 200 Tests

Mouse Spaca7b qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-HP1 gamma Antibody
DL94097A-01 50 µL

Rabbit anti-HP1 gamma Antibody

Sign In for Pricing
View Details
Rabbit anti-HP1 gamma Antibody
DL94097A-02 100 µL

Rabbit anti-HP1 gamma Antibody

Sign In for Pricing
View Details