Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Product Specifications

Product Name Alternative

Ia antigen-associated invariant chain ; IiMHC class II-associated invariant chain; CD74

Abbreviation

Recombinant Rat Cd74 protein, partial

Gene Name

Cd74

UniProt

P10247

Expression Region

57-280aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Molecular Weight

29.5 kDa

References & Citations

Nucleotide sequence of rat invariant gamma chain cDNA clone pLR gamma 34.3.Henkes W., Syha J., Reske K.Nucleic Acids Res. 16:11822-11822 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCL3
Z100677 100 µg

Recombinant Human CCL3

Sign In for Pricing
View Details
Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24
MBS146606-01 0.002 mg

Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24

Sign In for Pricing
View Details
Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24
MBS146606-02 0.01 mg

Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24

Sign In for Pricing
View Details
Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24
MBS146606-03 1 mg

Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24

Sign In for Pricing
View Details
Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24
MBS146606-04 5x 1 mg

Recombinant Human DnaJ (Hsp40) Homolog, Subfamily C, Member 24

Sign In for Pricing
View Details
SNRK Antibody (Center)
E45R05865G-1 100 µL

SNRK Antibody (Center)

Sign In for Pricing
View Details