Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell antigen CD7 (CD7), partial

Product Specifications

Product Name Alternative

GP40T-cell leukemia antigen; T-cell surface antigen Leu-9TP41; CD7

Abbreviation

Recombinant Human CD7 protein, partial

Gene Name

CD7

UniProt

P09564

Expression Region

26-180aa

Organism

Homo sapiens (Human)

Target Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Not yet known.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Not yet known.

Molecular Weight

32.4 kDa

References & Citations

"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KL1 Rabbit Polyclonal Antibody
E10G34081 100 µL

RPS6KL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDH11 Monoclonal Antibody
BT-MCA3312-01 50 µL

CDH11 Monoclonal Antibody

Sign In for Pricing
View Details
CDH11 Monoclonal Antibody
BT-MCA3312-02 100 µL

CDH11 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT
E2572Mo-01 48 Well

Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT

Sign In for Pricing
View Details
Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT
E2572Mo-02 96 Well

Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT

Sign In for Pricing
View Details
Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT
E2572Mo-03 5x 96 Tests

Mouse Xin actin-binding repeat-containing protein 1, XIRP1 ELISA KIT

Sign In for Pricing
View Details