Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UPF0565 protein C2orf69 (C2orf69)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human C2orf69 protein

Gene Name

C2orf69

UniProt

Q8N8R5

Expression Region

25-385aa

Organism

Homo sapiens (Human)

Target Sequence

SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (B33/20), CF488A conjugate, 0.1mg/mL
BNC880952-100 1x 100 µL

Human IgG Immunoglobulin (B33/20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL
BNC742867-500 1x 500 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF647 conjugate, 0.1mg/mL
BNC471532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), CF594 conjugate, 0.1mg/mL
BNC940860-500 1x 500 µL

Human Lambda Light Chain (Lamb14), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details