Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA (CCL20)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rhesus macaque CCL20 protein

Gene Name

CCL20

UniProt

Q8HYP6

Expression Region

27-96aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.1 kDa

References & Citations

Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines.Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA3 Polyclonal Antibody
ANT-10009-50ug 50 µg

ABCA3 Polyclonal Antibody

Sign In for Pricing
View Details
17-Hydroxyprogesterone (17-OHP) ELISA Kit-Competitive
EK2F135 96 Tests

17-Hydroxyprogesterone (17-OHP) ELISA Kit-Competitive

Sign In for Pricing
View Details
TM4SF1 Antibody, Biotin conjugated
A36704-50UG 50 µg

TM4SF1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MBNL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1275608 1.0 µg DNA

MBNL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Wdfy2 (NM_175546) Mouse Tagged ORF Clone Lentiviral Particle
MR217140L3V 200 µL

Wdfy2 (NM_175546) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Msln ORF Vector (Rat) (pORF)
ORF070855 1.0 µg DNA

Msln ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details