Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA (CCL20)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rhesus macaque CCL20 protein

Gene Name

CCL20

UniProt

Q8HYP6

Expression Region

27-96aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.1 kDa

References & Citations

Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines.Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (HRP) discontinued
A0855-90D1-HRP 200 µL

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (HRP) discontinued

Sign In for Pricing
View Details
C3orf32 Protein Vector (Human) (pPM-C-His)
PV006356 500 ng

C3orf32 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Crucible Silica 15ml 41x25mm
CRU3004 1 Each

Crucible Silica 15ml 41x25mm

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SE11) YNFA Polyclonal Antibody
MBS7172618 Inquire

Rabbit anti-Escherichia coli (strain SE11) YNFA Polyclonal Antibody

Sign In for Pricing
View Details
Soluble Tumor Necrosis Factor α Receptor 2 (sTNF-α) Human ELISA Kit
95063 96 Tests

Soluble Tumor Necrosis Factor α Receptor 2 (sTNF-α) Human ELISA Kit

Sign In for Pricing
View Details
HDAC2 Monoclonal Antibody, Biotin Conjugated
bsm-52083R-Biotin 100 µL

HDAC2 Monoclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details