Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calpastatin (CAST)

Product Specifications

Product Name Alternative

Calpain inhibitor; Sperm BS-17 component

Abbreviation

Recombinant Human CAST protein

Gene Name

CAST

UniProt

P20810

Expression Region

1-667aa

Organism

Homo sapiens (Human)

Target Sequence

MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Specific inhibition of calpain (calcium-dependent cysteine protease) . Plays a key role in postmort tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Specific inhibition of calpain (calcium-dependent cysteine protease) . Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.

Molecular Weight

75.9 kDa

References & Citations

CDNA cloning of human calpastatin sequence homology among human, pig, and rabbit calpastatins.Asada K., Ishino Y., Shimada M., Shimojo T., Endo M., Kimizuka F., Kato I., Maki M., Hatanaka M., Murachi T.J. Enzym. Inhib. 3:49-56 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of isoform 4

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GalNAc b-O-BSA Colloidal Gold Conjugate, 1mL 40nm
CCG-1018-40 1 mL

GalNAc b-O-BSA Colloidal Gold Conjugate, 1mL 40nm

Sign In for Pricing
View Details
Human THAP5 activation kit by CRISPRa
GA116172 1 Kit

Human THAP5 activation kit by CRISPRa

Sign In for Pricing
View Details
Micos13 Mouse Gene Knockout Kit (CRISPR)
KN500256 1 Kit

Micos13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRF3 Recombinant Rabbit Monoclonal Antibody [SD2062]
ET1612-14 100 µL

IRF3 Recombinant Rabbit Monoclonal Antibody [SD2062]

Sign In for Pricing
View Details
NF-L Recombinant Chimeric Antibody Antibody
HA610282 100 µg

NF-L Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF405S conjugate, 0.1mg/mL
BNC042295-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details