Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-14 (CASP14)

Product Specifications

Product Name Alternative

Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE

Abbreviation

Recombinant Human CASP14 protein

Gene Name

CASP14

UniProt

P31944

Expression Region

153-240aa

Organism

Homo sapiens (Human)

Target Sequence

KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum . Ses to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin . In vitro has a preference for the substate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF . Involved in processing of prosaposin in the epidermis . May be involved in retinal pigment epithelium cell barrier function . Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum

Molecular Weight

37.2 kDa

References & Citations

Multiple pathways are involved in DNA degradation during keratinocyte terminal differentiation.Yamamoto-Tanaka M., Makino T., Motoyama A., Miyai M., Tsuboi R., Hibino T.Cell Death Dis. 5:E1181-E1181 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifna1 (NM_010502) Mouse Tagged ORF Clone
MG226585 10 µg

Ifna1 (NM_010502) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bcs1l Rat shRNA Plasmid (Locus ID 301514)
TL700853 1 Kit

Bcs1l Rat shRNA Plasmid (Locus ID 301514)

Sign In for Pricing
View Details
NFAT2 (NFATC1) (NM_172388) Human Untagged Clone
SC109490 10 µg

NFAT2 (NFATC1) (NM_172388) Human Untagged Clone

Sign In for Pricing
View Details
PAX7 (PAX7/497), CF405S conjugate, 0.1mg/mL
BNC040497-500 1x 500 µL

PAX7 (PAX7/497), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Anti-Cytokeratin 6a antibody (Mouse mAb)
GB15800-100 100 μL

Recombinant Anti-Cytokeratin 6a antibody (Mouse mAb)

Sign In for Pricing
View Details
Trimethyl borate
290741-01 250 g

Trimethyl borate

Sign In for Pricing
View Details