Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic anhydrase 1 (CA1)

Product Specifications

Product Name Alternative

Carbonate dehydratase I; Carbonic anhydrase B ; CAB; Carbonic anhydrase I ; CA-I

Abbreviation

Recombinant Human CA1 protein

Gene Name

CA1

UniProt

P00915

Expression Region

2-261aa

Organism

Homo sapiens (Human)

Target Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Molecular Weight

44.7 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA2 Peptide - N-terminal region (AAP87041)
AAP87041-100UG 100 µg

NCOA2 Peptide - N-terminal region (AAP87041)

Sign In for Pricing
View Details
Slr0151 Antibody
PHY5317S 150 μg

Slr0151 Antibody

Sign In for Pricing
View Details
Mouse St3gal6 qPCR Primer Pair
QM27690S 200 Tests

Mouse St3gal6 qPCR Primer Pair

Sign In for Pricing
View Details
Agtr1b Recombinant Protein (Rat)
RP189572 100 µg

Agtr1b Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Human LIPF
MBS7621060-01 0.01 mg

Recombinant Human LIPF

Sign In for Pricing
View Details
Recombinant Human LIPF
MBS7621060-02 0.05 mg

Recombinant Human LIPF

Sign In for Pricing
View Details