What is the catalog number for Recombinant Human Carbonic anhydrase 1 (CA1)?

The catalog number for Recombinant Human Carbonic anhydrase 1 (CA1) is CSB-EP004364HU.

What sizes are available for Recombinant Human Carbonic anhydrase 1 (CA1)?

Recombinant Human Carbonic anhydrase 1 (CA1) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Carbonic anhydrase 1 (CA1) come in?

Recombinant Human Carbonic anhydrase 1 (CA1) is available in 7 different pack sizes.

Is Recombinant Human Carbonic anhydrase 1 (CA1) in stock?

Recombinant Human Carbonic anhydrase 1 (CA1) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Carbonic anhydrase 1 (CA1)?

Recombinant Human Carbonic anhydrase 1 (CA1) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Carbonic anhydrase 1 (CA1)?

Estimated delivery time for Recombinant Human Carbonic anhydrase 1 (CA1) is approximately 15 business day(s), depending on your location.

Recombinant Human Carbonic anhydrase 1 (CA1)

Product Specifications

Product Name Alternative

Carbonate dehydratase I; Carbonic anhydrase B ; CAB; Carbonic anhydrase I ; CA-I

Abbreviation

Recombinant Human CA1 protein

Gene Name

CA1

UniProt

P00915

Expression Region

2-261aa

Organism

Homo sapiens (Human)

Target Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.

Molecular Weight

44.7 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.