Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immortalization up-regulated protein (IMUP)

Product Specifications

Product Name Alternative

Hepatocyte growth factor activator inhibitor type 2-related small protein ; H2RSP ; HAI-2-related small protein

Abbreviation

Recombinant Human IMUP protein

Gene Name

IMUP

UniProt

Q9GZP8

Expression Region

1-85aa

Organism

Homo sapiens (Human)

Target Sequence

MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.5 kDa

References & Citations

Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.Kim J.K., Ryll R., Ishizuka Y., Kato S.Gene 257:327-334 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP13 Rabbit Polyclonal Antibody
TA383144 100 µL

USP13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6,6'-((2R,5R)-1-(3,5-difluoro-4-(4-(4-fluorophenyl)piperidin-1-yl)phenyl)pyrrolidine-2,5-diyl)bis(5-fluoro-2-((S)-pyrrolidin-2-yl)-1H-benzo[d]imidazole)
TRC-D450903-25MG 25 mg

6,6'-((2R,5R)-1-(3,5-difluoro-4-(4-(4-fluorophenyl)piperidin-1-yl)phenyl)pyrrolidine-2,5-diyl)bis(5-fluoro-2-((S)-pyrrolidin-2-yl)-1H-benzo[d]imidazole)

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), Biotin conjugate, 0.1mg/mL
BNCB0778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®488A Rabbit Anti-FLAG, 1mg/mL
#20432 1x 100 µL

CF®488A Rabbit Anti-FLAG, 1mg/mL

Sign In for Pricing
View Details
Human NOX3 activation kit by CRISPRa
GA109421 1 Kit

Human NOX3 activation kit by CRISPRa

Sign In for Pricing
View Details
PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G5]
TA803225BM 100 µL

PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G5]

Sign In for Pricing
View Details