Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immortalization up-regulated protein (IMUP)

Product Specifications

Product Name Alternative

Hepatocyte growth factor activator inhibitor type 2-related small protein ; H2RSP ; HAI-2-related small protein

Abbreviation

Recombinant Human IMUP protein

Gene Name

IMUP

UniProt

Q9GZP8

Expression Region

1-85aa

Organism

Homo sapiens (Human)

Target Sequence

MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.5 kDa

References & Citations

Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.Kim J.K., Ryll R., Ishizuka Y., Kato S.Gene 257:327-334 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anisomycin
TRC-A673925-200MG 200 mg

Anisomycin

Sign In for Pricing
View Details
Automatic Nucleic Acid Extraction System BNPS-206
BNPS-206 1 Unit

Automatic Nucleic Acid Extraction System BNPS-206

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) (NM_001005619) Human Over-expression Lysate
LC423633 20 µg

Integrin beta 4 (ITGB4) (NM_001005619) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF594 conjugate, 0.1mg/mL
BNC942871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/1941), 0.2mg/mL
BNUB2377-500 1x 500 µL

Cycloxygenase-2 (COX-2) (COX2/1941), 0.2mg/mL

Sign In for Pricing
View Details
QPCT Antibody
KC-7754-01 50 μL

QPCT Antibody

Sign In for Pricing
View Details