Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anaphase-promoting complex subunit 15 (ANAPC15)

Product Specifications

Product Name Alternative

ANAPC15; C11orf51; HSPC020Anaphase-promoting complex subunit 15; APC15

Abbreviation

Recombinant Human ANAPC15 protein

Gene Name

ANAPC15

UniProt

P60006

Expression Region

1-121aa

Organism

Homo sapiens (Human)

Target Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assbly checkpoint. Also required for degradation of CDC20.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C

Molecular Weight

41.3 kDa

References & Citations

Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BCL7B, CT (BCL7B, B-cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3)
MBS6000681-01 0.2 mL

BCL7B, CT (BCL7B, B-cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3)

Ask
View Details
BCL7B, CT (BCL7B, B-cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3)
MBS6000681-02 5x 0.2 mL

BCL7B, CT (BCL7B, B-cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3)

Ask
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-01 48 Tests

Canine Peptide YY (PYY) ELISA Kit

Ask
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-02 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Ask
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-03 5x 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Ask
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-04 10x 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Ask
View Details