Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probetacellulin [Cleaved into: Betacellulin protein (BTC)

Product Specifications

Product Name Alternative

BTCProbetacellulin [Cleaved into: Betacellulin; BTC) ]

Abbreviation

Recombinant Human BTC protein

Gene Name

BTC

UniProt

P35070

Expression Region

32-178aa

Organism

Homo sapiens (Human)

Target Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Molecular Weight

43.6 kDa

References & Citations

Solution structure of betacellulin, a new member of EGF-family ligands.Miura K., Doura H., Aizawa T., Tada H., Seno M., Yamada H., Kawano K.Biochem. Biophys. Res. Commun. 294:1040-1046 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL
BNC682540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF647 conjugate, 0.1mg/mL
BNC470949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL
BNC471884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL
BNC682386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details