Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3)

Product Specifications

Product Name Alternative

BR; CA1-A complex subunit BR; CC36BR; CA1/BR; CA2-containing complex subunit 3BR; CA1/BR; CA2-containing complex subunit 36BRISC complex subunit BR; CC36

Abbreviation

Recombinant Human BRCC3 protein

Gene Name

BRCC3

UniProt

P46736

Expression Region

2-316aa

Organism

Homo sapiens (Human)

Target Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs) . In the BRCA1-A complex, it specifically roves 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs) . Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains

Molecular Weight

65.9 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITS3-ITS4 Library Preparation Kit for Illumina (Set C)
71130 96 Preparations

ITS3-ITS4 Library Preparation Kit for Illumina (Set C)

Sign In for Pricing
View Details
UBE1C (UBA3) (NM_003968) Human Recombinant Protein
TP304675L 1 mg

UBE1C (UBA3) (NM_003968) Human Recombinant Protein

Sign In for Pricing
View Details
Human TRAPPC2L activation kit by CRISPRa
GA109945 1 Kit

Human TRAPPC2L activation kit by CRISPRa

Sign In for Pricing
View Details
AFDN Polyclonal Antibody
E-AB-15958-01 20 µL

AFDN Polyclonal Antibody

Sign In for Pricing
View Details
AFDN Polyclonal Antibody
E-AB-15958-02 60 µL

AFDN Polyclonal Antibody

Sign In for Pricing
View Details
AFDN Polyclonal Antibody
E-AB-15958-03 120 µL

AFDN Polyclonal Antibody

Sign In for Pricing
View Details