Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Osteocalcin (Bglap)

Product Specifications

Product Name Alternative

Bone Gla protein ; BGPGamma-carboxyglutamic acid-containing protein

Abbreviation

Recombinant Rat Bglap protein

Gene Name

Bglap

UniProt

P04640

Expression Region

50-99aa

Organism

Rattus norvegicus (Rat)

Target Sequence

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Molecular Weight

32.6 kDa

References & Citations

Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-01 20 µL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details
Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-02 100 µL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details
Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-03 200 µL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details
Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-04 1 mL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details
MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)
MBS6218102-01 0.1 mL

MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)

Sign In for Pricing
View Details
MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)
MBS6218102-02 5x 0.1 mL

MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)

Sign In for Pricing
View Details