Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3 (Batf3)

Product Specifications

Product Name Alternative

Jun dimerization protein 1 ; JDP-1

Abbreviation

Recombinant Rat Batf3 protein

Gene Name

Batf3

UniProt

P97876

Expression Region

1-133aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

AP-1 family transcription factor that controls the differentiation of CD8 (+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha (+) classical dendritic cells (cDCs) and related CD103 (+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity) .

Molecular Weight

19.1 kDa

References & Citations

Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Heat shock 70 kDa protein 1-like, Hspa1l ELISA KIT
ELI-27757m 96 Tests

Mouse Heat shock 70 kDa protein 1-like, Hspa1l ELISA KIT

Ask
View Details
Rat Monoclonal Cystatin E/M/CST6 Antibody (RM0217-6F49) [Janelia Fluor 549]
NBP2-12252JF549 0.1 mL

Rat Monoclonal Cystatin E/M/CST6 Antibody (RM0217-6F49) [Janelia Fluor 549]

Ask
View Details
TOR3A CRISPRa sgRNA lentivector (set of three targets)(Rat)
47319126 3x 1.0µg DNA

TOR3A CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Human Chondroadherin (CHAD) ELISA Kit
MBS9942741-01 48 Well

Human Chondroadherin (CHAD) ELISA Kit

Ask
View Details
Human Chondroadherin (CHAD) ELISA Kit
MBS9942741-02 96 Well

Human Chondroadherin (CHAD) ELISA Kit

Ask
View Details
Human Chondroadherin (CHAD) ELISA Kit
MBS9942741-03 5x 96 Well

Human Chondroadherin (CHAD) ELISA Kit

Ask
View Details