Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Renin receptor (ATP6AP2)

Product Specifications

Product Name Alternative

ATP6M8-9 ; V-ATPase M8.9 subunit

Abbreviation

Recombinant Human ATP6AP2 protein

Gene Name

ATP6AP2

UniProt

O75787

Expression Region

17-350aa

Organism

Homo sapiens (Human)

Target Sequence

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin syst (RAS) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS) .

Molecular Weight

53.5 kDa

References & Citations

Altered splicing of ATP6AP2 causes X-linked parkinsonism with spasticity (XPDS) .Korvatska O., Strand N.S., Berndt J.D., Strovas T., Chen D.H., Leverenz J.B., Kiianitsa K., Mata I.F., Karakoc E., Greenup J.L., Bonkowski E., Chuang J., Moon R.T., Eichler E.E., Nickerson D.A., Zabetian C.P., Kraemer B.C., Bird T.D., Raskind W.H.Hum. Mol. Genet. 22:3259-3268 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC8 Rabbit pAb
E45R18140N 50 ul

SIGLEC8 Rabbit pAb

Sign In for Pricing
View Details
RPL36 Antibody
DF3710-01 100 µL

RPL36 Antibody

Sign In for Pricing
View Details
RPL36 Antibody
DF3710-02 200 µL

RPL36 Antibody

Sign In for Pricing
View Details
Olr950-set siRNA/shRNA/RNAi Lentivector (Rat)
34796096 4x 500 ng

Olr950-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Mouse Anti-KRoom Temperature19 Recombinant Antibody (ZG-0463F)
ZG-0463F Each

Mouse Anti-KRoom Temperature19 Recombinant Antibody (ZG-0463F)

Sign In for Pricing
View Details
PMN-VERWARMINGSWA.-GR4-RLL090 Pipe Markers for Water
268737 220 Roll (220 Marker (s) x 1 Roll)

PMN-VERWARMINGSWA.-GR4-RLL090 Pipe Markers for Water

Sign In for Pricing
View Details