Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aspartyl/asparaginyl beta-hydroxylase (ASPH), partial

Product Specifications

Product Name Alternative

Aspartate beta-hydroxylase ; ASP beta-hydroxylase; Peptide-aspartate beta-dioxygenase

Abbreviation

Recombinant Human ASPH protein, partial

Gene Name

ASPH

UniProt

Q12797

Expression Region

75-270aa

Organism

Homo sapiens (Human)

Target Sequence

FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Isoform 1

Molecular Weight

38.2 kDa

References & Citations

DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 6

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate
LY431693 100 µg

Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate

Sign In for Pricing
View Details
Fenthoxon Sulfoxide
TRC-F279015-25MG 25 mg

Fenthoxon Sulfoxide

Sign In for Pricing
View Details
2-Bromo-benzenethiol
TRC-B680385-500MG 500 mg

2-Bromo-benzenethiol

Sign In for Pricing
View Details
2,6-Diisopropylnaphthalene
TRC-D459365-5G 5 g

2,6-Diisopropylnaphthalene

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL
BNC401497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (C1A/711), CF488A conjugate, 0.1mg/mL
BNC880711-100 1x 100 µL

CD1a (C1A/711), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details