Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADP-ribosylation factor 6 (ARF6)

Product Specifications

Product Name Alternative

ADP ribosylation factor 6 ; ADP ribosylation factor protein 6; ADP-ribosylation factor 6; ARF6; ARF6_HUMAN; DKFZp564M0264; Small GTP binding protein ; Small GTPase

Abbreviation

Recombinant Human ARF6 protein

Gene Name

ARF6

UniProt

P62330

Expression Region

1-175aa

Organism

Homo sapiens (Human)

Target Sequence

MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton rodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Involved in epithelial polarization (By similarity) .Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.

Molecular Weight

36.1 kDa

References & Citations

Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.Malaby A.W., van den Berg B., Lambright D.G.Proc. Natl. Acad. Sci. U.S.A. 110:14213-14218 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TEAD4 antibody
PAab08584 100 µg

Anti-TEAD4 antibody

Sign In for Pricing
View Details
Recombinant Human HYOU1 protein, C-10*His Tag
MBS1560825-01 0.05 mg

Recombinant Human HYOU1 protein, C-10*His Tag

Sign In for Pricing
View Details
Recombinant Human HYOU1 protein, C-10*His Tag
MBS1560825-02 0.1 mg

Recombinant Human HYOU1 protein, C-10*His Tag

Sign In for Pricing
View Details
Recombinant Human HYOU1 protein, C-10*His Tag
MBS1560825-03 5x 0.1 mg

Recombinant Human HYOU1 protein, C-10*His Tag

Sign In for Pricing
View Details
Donkey Hemicentin-2 (HMCN2) ELISA Kit
MBS9928044 Inquire

Donkey Hemicentin-2 (HMCN2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Translation initiation factor eIF-2B subunit alpha(EIF2B1)
AP76987-01 20 µg

Recombinant Human Translation initiation factor eIF-2B subunit alpha(EIF2B1)

Sign In for Pricing
View Details