Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein C-III (Apoc3)

Product Specifications

Product Name Alternative

Apolipoprotein C3

Abbreviation

Recombinant Mouse Apoc3 protein

Gene Name

Apoc3

UniProt

P33622

Expression Region

21-99aa

Organism

Mus musculus (Mouse)

Target Sequence

EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Molecular Weight

24.9 kDa

References & Citations

Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal FEZ2 Antibody [DyLight 488]
NBP2-81716G 0.1 mL

Rabbit Polyclonal FEZ2 Antibody [DyLight 488]

Ask
View Details
TE-SDS pH 8.0
42020305-2 1 L

TE-SDS pH 8.0

Ask
View Details
Lentiviral human PCSK9 shRNA (UAS) - Lentiviral human PCSK9 shRNA (UAS) (100)
GTR15307293 1 Vial

Lentiviral human PCSK9 shRNA (UAS) - Lentiviral human PCSK9 shRNA (UAS) (100)

Ask
View Details
Anti-Human ALAD Polyclonal Antibody
HB118014-01 50 µg

Anti-Human ALAD Polyclonal Antibody

Ask
View Details
Anti-Human ALAD Polyclonal Antibody
HB118014-02 100 µg

Anti-Human ALAD Polyclonal Antibody

Ask
View Details
Rabbit Polyclonal SH2D1A Antibody [DyLight 594]
NBP2-99726DL594 0.1 mL

Rabbit Polyclonal SH2D1A Antibody [DyLight 594]

Ask
View Details