Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-III (APOC3)

Product Specifications

Product Name Alternative

Apolipoprotein C3

Abbreviation

Recombinant Human APOC3 protein

Gene Name

APOC3

UniProt

P02656

Expression Region

21-99aa

Organism

Homo sapiens (Human)

Target Sequence

SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma

Molecular Weight

24.8 kDa

References & Citations

Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.Protter A.A., Levy-Wilson B., Miller J., Bencen G., White T., Seilhamer J.J.DNA 3:449-456 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPRT (NM_014298) Human Recombinant Protein
TP720230M 50 µg

QPRT (NM_014298) Human Recombinant Protein

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), 1mg/mL
BNUM2306-50 1x 50 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), 1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF594 conjugate, 0.1mg/mL
BNC941623-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), 0.2mg/mL
BNUB2336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)
PDMM100174-01 20 µg

Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)
PDMM100174-02 100 µg

Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)

Sign In for Pricing
View Details