Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-II (APOC2)

Product Specifications

Product Name Alternative

Apolipoprotein C2

Abbreviation

Recombinant Human APOC2 protein

Gene Name

APOC2

UniProt

P02655

Expression Region

23-101aa

Organism

Homo sapiens (Human)

Target Sequence

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridic individuals, predominantly found in the VLDL and LDL.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.

Molecular Weight

24.9 kDa

References & Citations

The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.Fojo S.S., Law S.W., Brewer H.B. Jr.FEBS Lett. 213:221-226 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF568 conjugate, 0.1mg/mL
BNC683792-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRS3 Polyclonal Antibody
E-AB-16286-01 20 µL

BRS3 Polyclonal Antibody

Sign In for Pricing
View Details
BRS3 Polyclonal Antibody
E-AB-16286-02 60 µL

BRS3 Polyclonal Antibody

Sign In for Pricing
View Details
BRS3 Polyclonal Antibody
E-AB-16286-03 120 µL

BRS3 Polyclonal Antibody

Sign In for Pricing
View Details
BRS3 Polyclonal Antibody
E-AB-16286-04 200 µL

BRS3 Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L2 Rabbit Polyclonal Antibody
AP20550PU-N 100 µg

BCL2L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details