Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-1 complex subunit sigma-3 (AP1S3)

Product Specifications

Product Name Alternative

Adaptor protein complex AP-1 subunit sigma-1C; Adaptor-related protein complex 1 subunit sigma-1C; Clathrin assembly protein complex 1 sigma-1C small chain; Golgi adaptor HA1/AP1 adaptin sigma-1C subunit; Sigma 1C subunit of AP-1 clathrin; Sigma-adaptin 1C; Sigma1C-adaptin

Abbreviation

Recombinant Human AP1S3 protein

Gene Name

AP1S3

UniProt

Q96PC3

Expression Region

1-104aa

Organism

Homo sapiens (Human)

Target Sequence

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking

Molecular Weight

39.7 kDa

References & Citations

AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.Setta-Kaffetzi N., Simpson M.A., Navarini A.A., Patel V.M., Lu H.C., Allen M.H., Duckworth M., Bachelez H., Burden A.D., Choon S.E., Griffiths C.E., Kirby B., Kolios A., Seyger M.M., Prins C., Smahi A., Trembath R.C., Fraternali F. , Smith C.H., Barker J.N., Capon F.Am. J. Hum. Genet. 94:790-797 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 3

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 Recombinant Protein (Human)
RP082314 100 µg

PAX5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Double tray HxDxW 280x560x139mm, 2 trays w/ handel and lid
TE29328 1 Piece

Double tray HxDxW 280x560x139mm, 2 trays w/ handel and lid

Sign In for Pricing
View Details
Interleukin 31 (IL-31) (Biotin) discontinued
I8442-40E1 50 µg

Interleukin 31 (IL-31) (Biotin) discontinued

Sign In for Pricing
View Details
Human Trypsin Pan Specific ELISA Kit
NR-E10432-01 96 Tests

Human Trypsin Pan Specific ELISA Kit

Sign In for Pricing
View Details
Human Trypsin Pan Specific ELISA Kit
NR-E10432-02 2x 96 Tests

Human Trypsin Pan Specific ELISA Kit

Sign In for Pricing
View Details
Human Trypsin Pan Specific ELISA Kit
NR-E10432-03 4x 96 Tests

Human Trypsin Pan Specific ELISA Kit

Sign In for Pricing
View Details