Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2)

Product Specifications

Product Name Alternative

3-alpha-HSD;3Chlordecone reductase homolog HAKRD; Dihydrodiol dehydrogenase 2 ; DD-2 ; DD2Dihydrodiol dehydrogenase/bile acid-binding protein ; DD/BABPTrans-1,2-dihydrobenzene-1,2-diol dehydrogenase (EC:1.3.1.20) ; Type III 3-alpha-hydroxysteroid dehydrogenase (EC:1.1.1.357)

Abbreviation

Recombinant Human AKR1C2 protein

Gene Name

AKR1C2

UniProt

P52895

Expression Region

1-323aa

Organism

Homo sapiens (Human)

Target Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol) . Has a high bile-binding ability.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol) . Has a high bile-binding ability.

Molecular Weight

52.7 kDa

References & Citations

Molecular cloning of multiple cDNAs encoding human enzymes structurally related to 3 alpha-hydroxysteroid dehydrogenase.Qin K.-N., New M.I., Cheng K.-C.J. Steroid Biochem. Mol. Biol. 46:673-679 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETSAT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38835111 3x 1.0 µg

RETSAT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-ATM Antibody
YLD0683-01 50 µL

Rabbit anti-ATM Antibody

Sign In for Pricing
View Details
Rabbit anti-ATM Antibody
YLD0683-02 100 µL

Rabbit anti-ATM Antibody

Sign In for Pricing
View Details
C-Abl, phosphorylated (Thr735) (ABL1, v-abl, Abelson Murine Leukemia Viral Oncogene Homolog 1, ABL, c-ABL, JTK7, p150, Proto-Oncogene Tyrosine-Protein Kanase ABL1, v-abl)
C0013-06 100 µL

C-Abl, phosphorylated (Thr735) (ABL1, v-abl, Abelson Murine Leukemia Viral Oncogene Homolog 1, ABL, c-ABL, JTK7, p150, Proto-Oncogene Tyrosine-Protein Kanase ABL1, v-abl)

Sign In for Pricing
View Details
Recombinant Thermoplasma acidophilum Probable phosphoheptose isomerase (gmhA)
MBS1343504-01 0.02 mg (E-Coli)

Recombinant Thermoplasma acidophilum Probable phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details
Recombinant Thermoplasma acidophilum Probable phosphoheptose isomerase (gmhA)
MBS1343504-02 0.1 mg (E-Coli)

Recombinant Thermoplasma acidophilum Probable phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details