Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allograft inflammatory factor 1 (AIF1)

Product Specifications

Product Name Alternative

Ionized calcium-binding adapter molecule 1; Protein G1

Abbreviation

Recombinant Human AIF1 protein

Gene Name

AIF1

UniProt

P55008

Expression Region

2-147aa

Organism

Homo sapiens (Human)

Target Sequence

SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Molecular Weight

32.6 kDa

References & Citations

Characterization of a novel gene in the human major histocompatibility complex that encodes a potential new member of the I kappa B family of proteins.Albertella M.R., Campbell D.R.Hum. Mol. Genet. 3:793-799 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Anti-Quail IgY (H&L) - AcalephFluor594
CSA3678-01 100 µL

Goat Anti-Quail IgY (H&L) - AcalephFluor594

Ask
View Details
Goat Anti-Quail IgY (H&L) - AcalephFluor594
CSA3678-02 500 μL

Goat Anti-Quail IgY (H&L) - AcalephFluor594

Ask
View Details
Goat Anti-Quail IgY (H&L) - AcalephFluor594
CSA3678-03 1 mL

Goat Anti-Quail IgY (H&L) - AcalephFluor594

Ask
View Details
Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit
MBS9334645-01 48 Well

Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit

Ask
View Details
Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit
MBS9334645-02 96 Well

Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit

Ask
View Details
Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit
MBS9334645-03 5x 96 Well

Rat POU domain, class 6, transcription factor 1, POU6F1 ELISA Kit

Ask
View Details