Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Agouti-related protein (AGRP)

Product Specifications

Product Name Alternative

Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2

Abbreviation

Recombinant Human AGRP protein

Gene Name

AGRP

UniProt

O00253

Expression Region

21-132aa

Organism

Homo sapiens (Human)

Target Sequence

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R (By similarity) . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.

Molecular Weight

28.5 kDa

References & Citations

Functional analysis of the Ala67Thr polymorphism in agouti related protein associated with anorexia nervosa and leanness.de Rijke C.E., Jackson P.J., Garner K.M., van Rozen R.J., Douglas N.R., Kas M.J., Millhauser G.L., Adan R.A.Biochem. Pharmacol. 70:308-316 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARHGEF6 Peptide
DF9865-BP 1 mg

ARHGEF6 Peptide

Ask
View Details
Ugt2b35 Protein Vector (Mouse) (pPM-C-HA)
49140024 500 ng

Ugt2b35 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, Trans-Golgi Network Protein 2)
493822 100 µL

TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, Trans-Golgi Network Protein 2)

Ask
View Details