Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDNF, Mouse (R129A, R130A, HEK293, C-His)

BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A mutation.

Product Specifications

Product Name Alternative

BDNF Protein, Mouse (R129A, R130A, HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bdnf-protein-mouse-r129a-r130a-hek293-c-his.html

Purity

97.60

Smiles

APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Formula

12064 (Gene_ID) P21237-1 (A19-R249, R129A, R130A) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuropilin 2 (NRP2) ELISA Kit
RDR-NRP2-Hu-01 96 Tests

Human Neuropilin 2 (NRP2) ELISA Kit

Sign In for Pricing
View Details
Human Neuropilin 2 (NRP2) ELISA Kit
RDR-NRP2-Hu-02 48 Tests

Human Neuropilin 2 (NRP2) ELISA Kit

Sign In for Pricing
View Details
AKAP7 (NM_016377) Human Tagged Lenti ORF Clone
RC219968L2 10 µg

AKAP7 (NM_016377) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated
MBS1494241-01 0.05 mg

Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated
MBS1494241-02 0.1 mg

Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated
MBS1494241-03 5x 0.1 mg

Rabbit anti-Clostridium tetani Tetanus toxin polyclonal Antibody(tetX), HRP conjugated

Sign In for Pricing
View Details